PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01189g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 760aa    MW: 82917.8 Da    PI: 7.1226
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01189g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095445811954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Niben101Scf01189g01003.1 544 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 581
                               664459******************************88 PP

2BELL120.95.4e-39405476172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA ka+SrhFrcLkdai+ q+
  Niben101Scf01189g01003.1 405 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAIPYTALAHKAMSRHFRCLKDAITAQL 476
                               589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.9E-79331474IPR006563POX domain
PfamPF075261.3E-53336473IPR006563POX domain
PROSITE profilePS5007112.568522585IPR001356Homeobox domain
CDDcd000861.75E-12525586No hitNo description
SMARTSM003891.2E-9525589IPR001356Homeobox domain
SuperFamilySSF466893.59E-17527592IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-29528591IPR009057Homeodomain-like
PfamPF059203.8E-18542581IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MGITSTPPRP SIVTSHNSKG HINPTILHQL SENPNSMSQD YHHQSLFSFP NGFERSQAEQ  60
QQQQQQQQHM AQQIRRDKLR VQGFESQPFE QETSGLPVYD QTAGMLSEMF NFPPGTSTEL  120
LEAQFNPNFR HPNPSQRSQT QQIPPPAGMG NEWLGNRQGM VVPLGYAKNH NNQISSAGIN  180
AAESMQLFLM NPQPRSPSPS PSHPPPPTNS STLHMLLPNP SSTSTLEGFP NPAEGSFGQF  240
TWGNNGGASA TLNVNHVVES QGLSLSLSSS LQHKAEELRM GEESGMLFFN QGGGGSTTSG  300
QFRYKNLNIG NSGLVGQNLH QQVHVGYGSS LGVVNVLRNS KYAKAAQELL EEFCSVGRGK  360
FKKNNKAAAA NPNSNNPSGG TNGGGGNNNT SSSSSKDLPP LSAADRIEHQ RRKVKLLSML  420
DEVDRRYNHY CEQMQMVVNS FDLVMGFGAA IPYTALAHKA MSRHFRCLKD AITAQLKHSC  480
EMLGDKDAGT SGLTKGETPR LKMLEQSLRQ QRAFHQMGMM EQEAWRPQRG LPERSVNILR  540
AWLFEHFLHP YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMVEEM YQQEAKEEDE  600
DDEKENSQNQ NSGNIAQTPT PNMSNSSSTN MTTTTTALGA AAAAAETGTA ATATTATATA  660
ASTLGKRSEI NAPENDPSLV AINSHISFSE NQATFPTNIH YSDAAACRRG SNFTGDDYGT  720
TTNTDVGSTM IRFGTTAGDV SLTLGLRHAG NLPDNTHFFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16531589563Homeobox protein Meis2
3k2a_B1e-16531589563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776283.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ9SW801e-158BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLK4BCE50.0K4BCE5_SOLLC; Uncharacterized protein
STRINGSolyc02g089940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-138BEL1-like homeodomain 2